PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10007248
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 377aa    MW: 41771.6 Da    PI: 7.2839
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10007248genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ ++ q+G+g +W + ++++g++R++k+c++rw++yl
      Lus10007248 14 KGPWSPEEDAKLKSYIDQHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding37.84.3e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd l+  +    G++ W+ Ia+ ++ gRt++++k++w++
      Lus10007248  69 GGFSEEEDNLICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.439962IPR017930Myb domain
SuperFamilySSF466893.89E-2611109IPR009057Homeodomain-like
SMARTSM007173.7E-121364IPR001005SANT/Myb domain
PfamPF002492.5E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-241569IPR009057Homeodomain-like
CDDcd001672.61E-91662No hitNo description
PROSITE profilePS5129421.76863117IPR017930Myb domain
SMARTSM007173.3E-1167115IPR001005SANT/Myb domain
PfamPF002497.2E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2370117IPR009057Homeodomain-like
CDDcd001672.15E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKSYID QHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNLIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
QHRKLHRKLT PTSTSGTKGR SEAAAAPDHG IANTSNNNNS NDQLINGLVI PASTSTQNQR  180
YWPPIPYANE ESRLNEQAAI RKLLLNLGGR FSSEDIHSSR HSHSHSSSAS MEGTEVVLQT  240
IQAVDHHNSD HHLEYCNNNT TVVDSLEAGG GSSSLDAGLE FLLSSGDPQE MMMVMSSTDI  300
ADHHHHVPKN NIIIDVDHHT TNFVSLAEGL LLHQSSRLMT TSHHHKEDDQ YYGFDAAGVD  360
QMMMMHPYQE GAARSM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002301137.21e-101hypothetical protein POPTR_0002s11440g
TrEMBLB9GNK51e-101B9GNK5_POPTR; Uncharacterized protein
STRINGPOPTR_0002s11440.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.14e-84myb domain protein 84